websmngrecouvryinfmanaegepyemntts.sreeka[..] Reviews

is websmngrecouvryinfmanaegepyemntts.sreeka[..] a scam or legit?

This site does not seem active (error 503). We are showing data from a previous scan.

What is your feeling about websmngrecouvryinfmanaegepyemntts.sreeka[..]?

websmngrecouvryinfmanaegepyemntts.sreeka[..] has a low trust score. Why?

The website might be a scam as we found several negative indicators for websmngrecouvryinfmanaegepyemntts.sreeka[..].

We automatically reviewed websmngrecouvryinfmanaegepyemntts.sreeka[..] by checking 40 different data point such has the location of the server, ratings given on other sites, malware reports, the source code being used and more. Scamadviser uses all this information to determine a trust score.

Based on our analysis we gave this website a low trust score. As the check is done manually and no algorithm is perfect, it is advisable to also do your own verification of the website before you buy or leave your contact details. Please feel free to use our checklist to see if the website is safe to use or fraudulent.

Positive highlights

According to the SSL check the certificate is valid 

DNSFilter considers this website safe

Negative highlights

This website does not have many visitors

This website is being iframed by another website
SHOW DETAILED ANALYSIS

Consumer reviews about websmngrecouvryinfmanaegepyemntts.sreeka[..]

Be the first one to review

No reviews have been left for websmngrecouvryinfmanaegepyemntts.sreeka[..] on ScamAdviser.com

Total reviews: 0 Average score: 0 stars Learn more

Advertorials

Wanted- B2C Marketing Manager / Growth Hacker
https://files.scamadviser.com/uploads/scamadviser-marketing-manager-ad-a3508.jpg

Are you a marketing guru with a passion for protecting consumers? ScamAdviser is on the hunt for a creative B2C Marketing Manager who can turn ideas into impactful actions. With a bachelor’s degree, 5+ years of online marketing savvy, and a flair for growth hacking, you’ll drive engagement, spearhead viral campaigns, and help us outsmart scammers. We offer a competitive salary, an attractive bonus package, a high degree of independence, and flexible working hours—all from the comfort of your home in an international environment. Ready to lead a global mission and be a key player in the fight against online fraud? Apply now by sending your LinkedIn profile here. We do not reply to recruitment agencies.

Download the ScamAdviser App & Browser Extensions
https://files.scamadviser.com/uploads/advertorial-banner-browser-extension-and-app-4f861.jpg

Avoid online scams effortlessly with ScamAdviser! Our free app, available in beta for Android and iOS, and browser extensions for Google Chrome, Microsoft Edge, and Safari, provide real-time alerts to help you determine if a website is legitimate or a scam. Install ScamAdviser on multiple devices, including those of your family and friends, to ensure everyone's online safety.

Complete Review websmngrecouvryinfmanaegepyemntts.sreeka[..]

Webshop Evaluation

In our Analysis we always check the Tranco ranking. In this case it was low. A low Tranco ranking means that the website has relatively few visitors. For a new website this is logical. The same is true for a highly specialized website. However if the website claims to be a large corporate or popular site, than warning flags should be raised.

Technical Evaluation

This website is using an iframe or other technology to include content and functionalities located on another website. We consider this suspicious. Most professional and large scale websites hardly ever do this.

We found a valid SSL Certificate. An SSL certificate is used to secure communication between your computer and the website. There are different levels of SSL certification. A free one is also available and this one is used by online scammers. Still, not having an SSL certificate is worse than having one, especially if you have to enter your contact details.

Facts about websmngrecouvryinfmanaegepyemntts.sreeka[..]

Key facts
Domain age
2 years from now
WHOIS data
hidden
Website data
Website
websmngrecouvryinfmanaegepyemntts.sreekaridevelopers.com
Title
Amazon.com
Domain age
2 years from now
Website Speed
Very Fast
SSL certificate valid
valid
SSL type
Low - Domain Validated Certificates (DV SSL)
SSL issuer
Let's Encrypt
WHOIS registration date
2022-09-24
WHOIS last update date
2022-11-18
WHOIS renew date
2024-09-24
Tags
Gift Card - Brands, Amazon Phishing, Language - English
Server
ISP
Newfold Digital Inc.
Country
US
Registrar
Name
GoDaddy.com, LLC
IANA ID
146
Register website
http://www.godaddy.com
E-mail
abuse@godaddy.com
Phone
480-624-2505
Server name
IP
50.6.168.124

Request HTTP status
200

Target
ns24.ethii.com.
IP
147.124.209.117
Country
US

Target
ns25.ethii.com.
IP
147.124.209.117
Country
US

Is this your website?

If you own this website you can update your company data and manage your reviews for free.

 
About this report

The rating of websmngrecouvryinfmanaegepyemntts.sreeka[..] has been viewed 1 times.
First analyzed: 2024-09-22 14:36:33. Last updated: 2024-09-22 14:36:33

Popular Stories

As the influence of the internet rises, so does the prevalence of online scams. There are fraudsters making all kinds of claims to trap victims online - from fake investment opportunities to online stores - and the internet allows them to operate from any part of the world with anonymity. The ability to spot online scams is an important skill to have as the virtual world is increasingly becoming a part of every facet of our lives. The below tips will help you identify the signs which can indicate that a website could be a scam. Common Sense: Too Good To Be True When looking for goods online, a great deal can be very enticing. A Gucci bag or a new iPhone for half the price? Who wouldn’t want to grab such a deal? Scammers know this too and try to take advantage of the fact. If an online deal looks too good to be true, think twice and double-check things. The easiest way to do this is to simply check out the same product at competing websites (that you trust). If the difference in prices is huge, it might be better to double-check the rest of the website. Check Out the Social Media Links Social media is a core part of ecommerce businesses these days and consumers often expect online shops to have a social media presence. Scammers know this and often insert logos of social media sites on their websites. Scratching beneath the surface often reveals this fu

So the worst has come to pass - you realise you parted with your money too fast, and the site you used was a scam - what now? Well first of all, don’t despair!! If you think you have been scammed, the first port of call when having an issue is to simply ask for a refund. This is the first and easiest step to determine whether you are dealing with a genuine company or scammers. Sadly, getting your money back from a scammer is not as simple as just asking.  If you are indeed dealing with scammers, the procedure (and chance) of getting your money back varies depending on the payment method you used. PayPal Debit card/Credit card Bank transfer Wire transfer Google Pay Bitcoin PayPal If you used PayPal, you have a strong chance of getting your money back if you were scammed. On their website, you can file a dispute within 180 calendar days of your purchase. Conditions to file a dispute: The simplest situation is that you ordered from an online store and it has not arrived. In this case this is what PayPal states: "If your order never shows up and the seller can't provide proof of shipment or delivery, you'll get a full refund. It's that simple." The scammer has sent you a completely different item. For example, you ordered a PlayStation 4, but instead received only a Playstation controller.  The condition of the item was misrepresented on the product page. This could be the

Help & Info