akfrstgrshmnsmdqweqweqweqwe.click Reviews
is akfrstgrshmnsmdqweqweqweqwe.click legit or a scam?
Why does akfrstgrshmnsmdqweqweqweqwe.click have a very low trust score?
akfrstgrshmnsmdqweqweqweqwe.click has a very low trust score which indicates that there is a strong likelyhood the website is a scam. Be very careful when using this website!
When our algorithm automatically reviewed akfrstgrshmnsmdqweqweqweqwe.click we looked at many factors, such as the ownership details, location, popularity and other factors relating to reviews, fake products, threats and phishing. A trust score is created using all the collected data.
Although the website seems to have a very low rating, be aware that our algorithm is not perfect. It may not be a scam but a legit and safe site. It is therefore always wise to do your own research as well.
The SSL certificate is valid
The owner of the website is using a service to hide their identity on WHOIS
According to Tranco this site has a low rank
The registrar has a high % of spammers and fraud sites
This website is (very) young.
This website has been reported for phishing by iQ Abuse Scan
This website has been marked as threat by DNSFilter in the last 30 days
Pulsedive reports elevated risk with this website.
This website has been reported as unsafe by Maltiverse
This website has been reported for Phishing by IPQS
This website has been reported as Suspicious by IPQS
No reviews have been left for akfrstgrshmnsmdqweqweqweqwe.click on ScamAdviser.com
Are you a marketing guru with a passion for protecting consumers? ScamAdviser is on the hunt for a creative B2C Marketing Manager who can turn ideas into impactful actions. With a bachelor’s degree, 5+ years of online marketing savvy, and a flair for growth hacking, you’ll drive engagement, spearhead viral campaigns, and help us outsmart scammers. We offer a competitive salary, an attractive bonus package, a high degree of independence, and flexible working hours—all from the comfort of your home in an international environment. Ready to lead a global mission and be a key player in the fight against online fraud? Apply now by sending your LinkedIn profile here. We do not reply to recruitment agencies.
Avoid online scams effortlessly with ScamAdviser! Our free app, available in beta for Android and iOS, and browser extensions for Google Chrome, Microsoft Edge, and Safari, provide real-time alerts to help you determine if a website is legitimate or a scam. Install ScamAdviser on multiple devices, including those of your family and friends, to ensure everyone's online safety.
Full review akfrstgrshmnsmdqweqweqweqwe.click
We see that the owner of the website is using a service to hide his/her identity. This may be because the owner does not want to get spammed. However, it also makes it difficult to identify the real owner of the website. As a result, websites hiding their identity get a slightly lower score.
According to Tranco this site has a low Tranco rank. This means that the number of visitors to this website is quite low. You can expect this from a small, starting or niche website. A popular website however should have a higher ranking.
The domain has only been registered recently. We recommend you to be cautious when buying or using services from a website that is very young. You may like to check our blog: "How to recognize a scam". Websites of scammers often only last for a few months before they are taken offline. An old website is no guarantee that the site is safe. Some scam sites are even years old. Most scam sites however are taken down after a few months as the number of consumer complaints rises and the hosting company is getting tired of the many emails and phone calls.
iQ Abuse Scan has reported this website for phishing. Phishing is a type of social engineering where an attacker sends a fraudulent message designed to trick a person into revealing sensitive information or to deploy malicious software on the victim's computer such as ransomware. It may even be that the website itself is unaware that it is supporting phishing activities. It may have been hacked.
Technical Analysis
This registrar has a high percentage of spammers and fraud sites. The domain registration company seems to attract websites with a low to very low trust score. This may be a chance but it may also because the "Know your customer" process of the registrar is poor or non-existing. We reduced the trust score of the website as a result.
A valid SSL certificate was found. Professional companies use an SSL certificate to encrypt communication between your computer and their website. However, there are different levels of certification and scammers also install a free SSL certificate. If you have to enter your data, never do this without checking if an SSL certificate protects your information.
Maltiverse has identified this website as being currently involved in malicious or suspicious activities. It is therefore considered to be potentially harmful.
If you own this website you can update your company data and manage your reviews for free.
The review report of akfrstgrshmnsmdqweqweqweqwe.click has been requested 1 times.
First analyzed: 2024-12-21 00:01:19.
Last updated: 2024-12-21 00:01:19
As the influence of the internet rises, so does the prevalence of online scams. There are fraudsters making all kinds of claims to trap victims online - from fake investment opportunities to online stores - and the internet allows them to operate from any part of the world with anonymity. The ability to spot online scams is an important skill to have as the virtual world is increasingly becoming a part of every facet of our lives. The below tips will help you identify the signs which can indicate that a website could be a scam. Common Sense: Too Good To Be True When looking for goods online, a great deal can be very enticing. A Gucci bag or a new iPhone for half the price? Who wouldn’t want to grab such a deal? Scammers know this too and try to take advantage of the fact. If an online deal looks too good to be true, think twice and double-check things. The easiest way to do this is to simply check out the same product at competing websites (that you trust). If the difference in prices is huge, it might be better to double-check the rest of the website. Check Out the Social Media Links Social media is a core part of ecommerce businesses these days and consumers often expect online shops to have a social media presence. Scammers know this and often insert logos of social media sites on their websites. Scratching beneath the surface often reveals this fu
So the worst has come to pass - you realise you parted with your money too fast, and the site you used was a scam - what now? Well first of all, don’t despair!! If you think you have been scammed, the first port of call when having an issue is to simply ask for a refund. This is the first and easiest step to determine whether you are dealing with a genuine company or scammers. Sadly, getting your money back from a scammer is not as simple as just asking. If you are indeed dealing with scammers, the procedure (and chance) of getting your money back varies depending on the payment method you used. PayPal Debit card/Credit card Bank transfer Wire transfer Google Pay Bitcoin PayPal If you used PayPal, you have a strong chance of getting your money back if you were scammed. On their website, you can file a dispute within 180 calendar days of your purchase. Conditions to file a dispute: The simplest situation is that you ordered from an online store and it has not arrived. In this case this is what PayPal states: "If your order never shows up and the seller can't provide proof of shipment or delivery, you'll get a full refund. It's that simple." The scammer has sent you a completely different item. For example, you ordered a PlayStation 4, but instead received only a Playstation controller. The condition of the item was misrepresented on the product page. This could be the